Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PROSER2 Peptide - C-terminal region

PROSER2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C10orf47

UniProt

D3DRR9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PROSER2 Rabbit Polyclonal Antibody (orb55698) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LCFRPGPALPSTRARQSFPGPRQPNGAQDWRRADSLPRPQGITVQFAGRG

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Vnn1 (Vanin 1) ELISA Kit
FY-EH4194 96 Well

Human Vnn1 (Vanin 1) ELISA Kit

Sign In for Pricing
View Details
Monkey Semaphorin 3D (SEMA3D) ELISA Kit
GTR10359650 96 Well

Monkey Semaphorin 3D (SEMA3D) ELISA Kit

Sign In for Pricing
View Details
PLBD1 siRNA (m)
sc-108134 10 µM

PLBD1 siRNA (m)

Sign In for Pricing
View Details
USP24 Antibody
MBS9507050-01 0.05 mL

USP24 Antibody

Sign In for Pricing
View Details
USP24 Antibody
MBS9507050-02 0.1 mL

USP24 Antibody

Sign In for Pricing
View Details
USP24 Antibody
MBS9507050-03 5x 0.1 mL

USP24 Antibody

Sign In for Pricing
View Details