Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKLN1 Peptide - N-terminal region

MKLN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TWA2

UniProt

Q9UL63

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MKLN1 Rabbit Polyclonal Antibody (orb583289) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037387

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADFWAYSVKENQWTCISRDTEKENGPSARSCHKMCIDIQRRQIYTLGRYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Semaphorin 5A/SEMA5A Protein (Fc Tag)
PKSH031162 50 µg

Recombinant Human Semaphorin 5A/SEMA5A Protein (Fc Tag)

Sign In for Pricing
View Details
Human Synaptogyrin 2 (SYNGR2) activation kit by CRISPRa
GA106095 1 Kit

Human Synaptogyrin 2 (SYNGR2) activation kit by CRISPRa

Sign In for Pricing
View Details
O-(2-Heptyl) Dabigatran Ethyl Ester
TRC-H282995-5MG 5 mg

O-(2-Heptyl) Dabigatran Ethyl Ester

Sign In for Pricing
View Details
Desmin (DES) (NM_001927) Human Over-expression Lysate
LY400713 100 µg

Desmin (DES) (NM_001927) Human Over-expression Lysate

Sign In for Pricing
View Details
Dynamin 2 (DNM2) Rabbit Polyclonal Antibody
TA375557 100 µL

Dynamin 2 (DNM2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Carboxy Polystyrene
H16020008.100G 100 g

Carboxy Polystyrene

Sign In for Pricing
View Details