Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKLN1 Peptide - N-terminal region

MKLN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TWA2

UniProt

Q9UL63

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MKLN1 Rabbit Polyclonal Antibody (orb583289) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037387

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADFWAYSVKENQWTCISRDTEKENGPSARSCHKMCIDIQRRQIYTLGRYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIF1 alpha (Hypoxia-Inducible Factor 1-alpha) (ESEE122), 0.2mg/mL
BNUB1574-100 1x 100 µL

HIF1 alpha (Hypoxia-Inducible Factor 1-alpha) (ESEE122), 0.2mg/mL

Sign In for Pricing
View Details
2-(3-Nitrophenyl)ethanamine
TRC-N545355-2.5G 2.5 g

2-(3-Nitrophenyl)ethanamine

Sign In for Pricing
View Details
D-2'-Deoxyribopyranosyl-3-guanylurea (Alpha/Beta-Mixture)
TRC-D253505-2.5MG 2.5 mg

D-2'-Deoxyribopyranosyl-3-guanylurea (Alpha/Beta-Mixture)

Sign In for Pricing
View Details
NPTX2 (NM_002523) Human Over-expression Lysate
LY419275 100 µg

NPTX2 (NM_002523) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin, LMW (KRTL/1077), CF568 conjugate, 0.1mg/mL
BNC681077-500 1x 500 µL

Cytokeratin, LMW (KRTL/1077), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RPB11 (POLR2J) (NM_006234) Human Recombinant Protein
TP304819M 100 µg

RPB11 (POLR2J) (NM_006234) Human Recombinant Protein

Sign In for Pricing
View Details