ACTL6B Peptide - middle region
ACTL6B Peptide - middle region
Product Specifications
Product Name Alternative
ACTL6, BAF53B, arpNalpha
UniProt
O94805
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACTL6B Rabbit Polyclonal Antibody (orb583344) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057272.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSV
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1602892 100 µL
Cyclin D2 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
Sign In for Pricing
View Details 
KTE30059-01 48 Tests
ELISA kit for Chicken Prolactin receptor (PRLR)
Sign In for Pricing
View Details 
KTE30059-02 96 Tests
ELISA kit for Chicken Prolactin receptor (PRLR)
Sign In for Pricing
View Details KTE30059-03 5x 96 Well
ELISA kit for Chicken Prolactin receptor (PRLR)
Sign In for Pricing
View Details