Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMU1 Peptide - N-terminal region

SMU1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BWD, RP11-54K16.3, SMU-1, fSAP57

UniProt

Q2TAY7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SMU1 Rabbit Polyclonal Antibody (orb583470) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060695

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDPMIMLKQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rex1bd Mouse Gene Knockout Kit (CRISPR)
KN500301 1 Kit

Rex1bd Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NR3B (GRIN3B) Human Gene Knockout Kit (CRISPR)
KN417549 1 Kit

NR3B (GRIN3B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tarsl2 Mouse Gene Knockout Kit (CRISPR)
KN517185 1 Kit

Tarsl2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cardboard Freezer Boxes
R2781-G 5 Units/Pack

Cardboard Freezer Boxes

Sign In for Pricing
View Details
Tiquizium Bromide
TRC-T445120-25MG 25 mg

Tiquizium Bromide

Sign In for Pricing
View Details
Skint4 Mouse Gene Knockout Kit (CRISPR)
KN515830 1 Kit

Skint4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details