SMU1 Peptide - N-terminal region
SMU1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
BWD, RP11-54K16.3, SMU-1, fSAP57
UniProt
Q2TAY7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SMU1 Rabbit Polyclonal Antibody (orb583470) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060695
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TDPMIMLKQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-M254325-250MG 250 mg
1-(9-Mercaptononyl)-3,6,9-trioxaundecan-11-ol
Sign In for Pricing
View Details ![Elab Fluor® Violet 610 Anti-Rat CD45 Antibody[OX-1]](https://cdn.genprice.uk/products/763/68dd1498061270361e7ce5b9/imageurl/e-ab-f1227ut.webp)
E-AB-F1227UT-01 25 µg
Elab Fluor® Violet 610 Anti-Rat CD45 Antibody[OX-1]
Sign In for Pricing
View Details E-AB-F1227UT-02 100 µg
Elab Fluor® Violet 610 Anti-Rat CD45 Antibody[OX-1]
Sign In for Pricing
View Details 
TRC-P319705-50MG 50 mg
Phenyl 3,4-Di-O-acetyl-Alpha-O-benzyl-1-thio-Alpha-L-rhamnopyranoside
Sign In for Pricing
View Details 
TP324460L 1 mg
eEF1A2 binding protein (IGFN1) (NM_178275) Human Recombinant Protein
Sign In for Pricing
View Details