Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJA4 Peptide - C-terminal region

DNAJA4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MST104, MSTP104, PRO1472

UniProt

Q8WW22

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJA4 Rabbit Polyclonal Antibody (orb326178) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001123654.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVELKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDH1 (IDH1/1152), CF640R conjugate, 0.1mg/mL
BNC401152-500 1x 500 µL

IDH1 (IDH1/1152), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ITGB1BP2 Antibody
KC-3646-01 50 μL

ITGB1BP2 Antibody

Sign In for Pricing
View Details
ITGB1BP2 Antibody
KC-3646-02 100 µL

ITGB1BP2 Antibody

Sign In for Pricing
View Details
ITGB1BP2 Antibody
KC-3646-03 1 mL

ITGB1BP2 Antibody

Sign In for Pricing
View Details
Recombinant Mouse GM-CSF
6511 5 µg

Recombinant Mouse GM-CSF

Sign In for Pricing
View Details
Human MYOM2 activation kit by CRISPRa
GA106114 1 Kit

Human MYOM2 activation kit by CRISPRa

Sign In for Pricing
View Details