DNAJA4 Peptide - C-terminal region
DNAJA4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MST104, MSTP104, PRO1472
UniProt
Q8WW22
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DNAJA4 Rabbit Polyclonal Antibody (orb326178) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001123654.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVELKE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Glutathione Reductase (GSR) Mouse Monoclonal Antibody [Clone ID: AT11D10]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd8f8/imageurl/am50347pu-s.webp)
AM50347PU-S 50 µL
Glutathione Reductase (GSR) Mouse Monoclonal Antibody [Clone ID: AT11D10]
Sign In for Pricing
View Details 