Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELMOD1 Peptide - N-terminal region

ELMOD1 Peptide - N-terminal region

Product Specifications

UniProt

Q8N336

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELMOD1 Rabbit Polyclonal Antibody (orb583510) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061182

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYT7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0646005 3x 1.0 µg

DYT7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Sheep AKAP1 (A Kinase Anchor Protein 1) ELISA Kit
MBS2510886-01 24 Tests

Sheep AKAP1 (A Kinase Anchor Protein 1) ELISA Kit

Sign In for Pricing
View Details
Sheep AKAP1 (A Kinase Anchor Protein 1) ELISA Kit
MBS2510886-02 48 Tests

Sheep AKAP1 (A Kinase Anchor Protein 1) ELISA Kit

Sign In for Pricing
View Details
Sheep AKAP1 (A Kinase Anchor Protein 1) ELISA Kit
MBS2510886-03 96 Tests

Sheep AKAP1 (A Kinase Anchor Protein 1) ELISA Kit

Sign In for Pricing
View Details
Sheep AKAP1 (A Kinase Anchor Protein 1) ELISA Kit
MBS2510886-04 5x 96 Tests

Sheep AKAP1 (A Kinase Anchor Protein 1) ELISA Kit

Sign In for Pricing
View Details
Sheep AKAP1 (A Kinase Anchor Protein 1) ELISA Kit
MBS2510886-05 10x 96 Tests

Sheep AKAP1 (A Kinase Anchor Protein 1) ELISA Kit

Sign In for Pricing
View Details