Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELMOD1 Peptide - N-terminal region

ELMOD1 Peptide - N-terminal region

Product Specifications

UniProt

Q8N336

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELMOD1 Rabbit Polyclonal Antibody (orb583510) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061182

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SLC33A1 sgRNA gene knockout kit - Lentiviral human SLC33A1 sgRNA gene knockout kit (plasmid)
GTR15364481 1 Vial

Lentiviral human SLC33A1 sgRNA gene knockout kit - Lentiviral human SLC33A1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
PRND Antibody
DF15565-01 100 µL

PRND Antibody

Sign In for Pricing
View Details
PRND Antibody
DF15565-02 200 µL

PRND Antibody

Sign In for Pricing
View Details
HUMAN PHYSIOLOGY Female Reproductive System
4062850/13 1 Each

HUMAN PHYSIOLOGY Female Reproductive System

Sign In for Pricing
View Details
GENLISA Human Diazepam Binding Inhibitor (DBI) ELISA
KBH9942 1x 96 Well

GENLISA Human Diazepam Binding Inhibitor (DBI) ELISA

Sign In for Pricing
View Details
L-α-Phosphatidyl-L-serine from Glycine max (soybean)
B2017394 25 mg

L-α-Phosphatidyl-L-serine from Glycine max (soybean)

Sign In for Pricing
View Details