COG6 Peptide - C-terminal region
COG6 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CDG2L, COD2
UniProt
Q9Y2V7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with COG6 Rabbit Polyclonal Antibody (orb326204) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065802
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ADMATFMVNSLYMMKTTLALFEFTDRRLEMLQFQIEAHLDTLINEQASYV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-A922790-250MG 250 mg
(3-Azidopropyl)triphenylphosphonium Bromide
Sign In for Pricing
View Details 
E-EL-M0051-01 24 Tests
Mouse TGF-β1 (Transforming Growth Factor Beta 1) ELISA Kit
Sign In for Pricing
View Details E-EL-M0051-02 48 Tests
Mouse TGF-β1 (Transforming Growth Factor Beta 1) ELISA Kit
Sign In for Pricing
View Details E-EL-M0051-03 96 Tests
Mouse TGF-β1 (Transforming Growth Factor Beta 1) ELISA Kit
Sign In for Pricing
View Details 