Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COG6 Peptide - C-terminal region

COG6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDG2L, COD2

UniProt

Q9Y2V7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COG6 Rabbit Polyclonal Antibody (orb326204) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065802

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADMATFMVNSLYMMKTTLALFEFTDRRLEMLQFQIEAHLDTLINEQASYV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sec-Butyl Acetate
TRC-B699330-2.5G 2.5 g

sec-Butyl Acetate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701877 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Smdt1 Mouse Gene Knockout Kit (CRISPR)
KN516308 1 Kit

Smdt1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WNT3A (NM_033131) Human Over-expression Lysate
LY403226 100 µg

WNT3A (NM_033131) Human Over-expression Lysate

Sign In for Pricing
View Details
RFC3 Mouse Monoclonal Antibody [Clone ID: OTI3F6]
CF811874 100 µg

RFC3 Mouse Monoclonal Antibody [Clone ID: OTI3F6]

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/903), CF640R conjugate, 0.1mg/mL
BNC400903-100 1x 100 µL

Cytokeratin 7 (KRT7/903), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details