Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP36 Peptide - N-terminal region

USP36 Peptide - N-terminal region

Product Specifications

UniProt

Q8IXW9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP36 Rabbit Polyclonal Antibody (orb583656) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLKEALKPGRKDSADDGELGKLLASSAKKVLLQKIEFEPASKSFSYQLEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDC1 (Phospho-Ser513) Antibody
MBS9503379-01 0.05 mL

MDC1 (Phospho-Ser513) Antibody

Sign In for Pricing
View Details
MDC1 (Phospho-Ser513) Antibody
MBS9503379-02 0.1 mL

MDC1 (Phospho-Ser513) Antibody

Sign In for Pricing
View Details
MDC1 (Phospho-Ser513) Antibody
MBS9503379-03 5x 0.1 mL

MDC1 (Phospho-Ser513) Antibody

Sign In for Pricing
View Details
AFAP1L2 sgRNA CRISPR Lentivector (Human) (Target 3)
K0054604 1.0 µg DNA

AFAP1L2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Mouse KHDC1C Protein, His (Fc)-Avi-tagged
KHDC1C-4795M 50 µg

Recombinant Mouse KHDC1C Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Human CCSER2 Pre-designed siRNA Set A
SI002512A 1 Each

Human CCSER2 Pre-designed siRNA Set A

Sign In for Pricing
View Details