Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP36 Peptide - N-terminal region

USP36 Peptide - N-terminal region

Product Specifications

UniProt

Q8IXW9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP36 Rabbit Polyclonal Antibody (orb583656) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLKEALKPGRKDSADDGELGKLLASSAKKVLLQKIEFEPASKSFSYQLEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scn10a ORF Vector (Mouse) (pORF)
43174015 1.0 µg DNA

Scn10a ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
LXN Rabbit pAb
E2820935 100 µL

LXN Rabbit pAb

Sign In for Pricing
View Details
Fatty Acid Binding Protein 1, Liver (FABP1) Antibody
abx129927-01 100 µL

Fatty Acid Binding Protein 1, Liver (FABP1) Antibody

Sign In for Pricing
View Details
Fatty Acid Binding Protein 1, Liver (FABP1) Antibody
abx129927-02 200 µL

Fatty Acid Binding Protein 1, Liver (FABP1) Antibody

Sign In for Pricing
View Details
Fatty Acid Binding Protein 1, Liver (FABP1) Antibody
abx129927-03 1 mL

Fatty Acid Binding Protein 1, Liver (FABP1) Antibody

Sign In for Pricing
View Details
5' TET / 3' TAMRA
FP-103-05 5 to 9 nmol

5' TET / 3' TAMRA

Sign In for Pricing
View Details