Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF676 Peptide - middle region

ZNF676 Peptide - middle region

Product Specifications

UniProt

Q8N7Q3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF676 Rabbit Polyclonal Antibody (orb583874) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001411

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSTLTYYKSIHTGEKPYKCEECGKAFSKFSILTKHKVIHTGEKPYKCEEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAP30L Human Over-expression Lysate
orb1371264 20 µg

SAP30L Human Over-expression Lysate

Sign In for Pricing
View Details
NFIC Polyclonal Antibody, PE-Cy5 Conjugated
bs-8171R-PE-Cy5 100 µL

NFIC Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
ICOS Protein, Rat, Recombinant (hFc Tag)
PR53695M4 100 µg

ICOS Protein, Rat, Recombinant (hFc Tag)

Sign In for Pricing
View Details
MAP2K5 Antibody (S137) Blocking peptide
orb1445718 500 µg

MAP2K5 Antibody (S137) Blocking peptide

Sign In for Pricing
View Details
Aflavazole
MBS5787719 Inquire

Aflavazole

Sign In for Pricing
View Details
HIV1 gp120 antibody (HRP)
60-H14 1 ml

HIV1 gp120 antibody (HRP)

Sign In for Pricing
View Details