Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF676 Peptide - middle region

ZNF676 Peptide - middle region

Product Specifications

UniProt

Q8N7Q3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF676 Rabbit Polyclonal Antibody (orb583874) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001411

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSTLTYYKSIHTGEKPYKCEECGKAFSKFSILTKHKVIHTGEKPYKCEEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha 1-Antichymotrypsin (ACT) ELISA Kit
MBS580161-01 96 Tests

Alpha 1-Antichymotrypsin (ACT) ELISA Kit

Sign In for Pricing
View Details
Alpha 1-Antichymotrypsin (ACT) ELISA Kit
MBS580161-02 5x 96 Tests

Alpha 1-Antichymotrypsin (ACT) ELISA Kit

Sign In for Pricing
View Details
Alpha 1-Antichymotrypsin (ACT) ELISA Kit
MBS580161-03 10x 96 Tests

Alpha 1-Antichymotrypsin (ACT) ELISA Kit

Sign In for Pricing
View Details
OR4D1
402959-01 50 µL

OR4D1

Sign In for Pricing
View Details
OR4D1
402959-02 100 µL

OR4D1

Sign In for Pricing
View Details
Acrylamide M-Bis solution 50% 24/1, 1l
1807-1l 1 L

Acrylamide M-Bis solution 50% 24/1, 1l

Sign In for Pricing
View Details