Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOB2 Peptide - middle region

TOB2 Peptide - middle region

Product Specifications

Product Name Alternative

TOB4, TOBL, TROB2

UniProt

Q14106

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOB2 Rabbit Polyclonal Antibody (orb583875) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057356

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroglobulin (TG) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8F4]
TA804209AM 100 µL

Thyroglobulin (TG) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8F4]

Sign In for Pricing
View Details
Anti-Human CD3-FITC/CD19-PE Cocktail
E-AB-FC0004-01 20 Tests

Anti-Human CD3-FITC/CD19-PE Cocktail

Sign In for Pricing
View Details
Anti-Human CD3-FITC/CD19-PE Cocktail
E-AB-FC0004-02 100 Tests

Anti-Human CD3-FITC/CD19-PE Cocktail

Sign In for Pricing
View Details
Anti-Human CD3-FITC/CD19-PE Cocktail
E-AB-FC0004-03 2x 100 Tests

Anti-Human CD3-FITC/CD19-PE Cocktail

Sign In for Pricing
View Details
HSP27 (HSPB1) Rabbit Monoclonal Antibody [Clone ID: SAIC-23C-35]
TA385892 200 µg

HSP27 (HSPB1) Rabbit Monoclonal Antibody [Clone ID: SAIC-23C-35]

Sign In for Pricing
View Details
N6-(2-Hydroxyethyl)-2'-deoxyadenosine
TRC-H941985-25MG 25 mg

N6-(2-Hydroxyethyl)-2'-deoxyadenosine

Sign In for Pricing
View Details