Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOB2 Peptide - middle region

TOB2 Peptide - middle region

Product Specifications

Product Name Alternative

TOB4, TOBL, TROB2

UniProt

Q14106

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOB2 Rabbit Polyclonal Antibody (orb583875) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057356

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Huntingtin Associated Protein 1 (HAP1) (NM_001079871) Human Over-expression Lysate
LY421569 100 µg

Huntingtin Associated Protein 1 (HAP1) (NM_001079871) Human Over-expression Lysate

Sign In for Pricing
View Details
MTX2 Antibody
KC-44327-01 50 μL

MTX2 Antibody

Sign In for Pricing
View Details
MTX2 Antibody
KC-44327-02 100 µL

MTX2 Antibody

Sign In for Pricing
View Details
MTX2 Antibody
KC-44327-03 1 mL

MTX2 Antibody

Sign In for Pricing
View Details
CEND1 (NM_016564) Human Over-expression Lysate
LY402575 100 µg

CEND1 (NM_016564) Human Over-expression Lysate

Sign In for Pricing
View Details
rac-Ibuprofen Amide
TRC-I140035-1G 1 g

rac-Ibuprofen Amide

Sign In for Pricing
View Details