Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK7 Peptide - N-terminal region

CDK7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAK1, CDKN7, HCAK, MO15, STK1, p39MO15

UniProt

P50613

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDK7 Rabbit Polyclonal Antibody (orb573765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001790

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometriotic tissue
CS808821 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
Mouse Wnt3 activation kit by CRISPRa
GA204637 1 Kit

Mouse Wnt3 activation kit by CRISPRa

Sign In for Pricing
View Details
Amoxycilloic Acid Sodium Salt
TRC-A634325-5MG 5 mg

Amoxycilloic Acid Sodium Salt

Sign In for Pricing
View Details
Hexametazidine
TRC-H291150-250MG 250 mg

Hexametazidine

Sign In for Pricing
View Details
KIAA1984 (CCDC183) Human Gene Knockout Kit (CRISPR)
KN421924 1 Kit

KIAA1984 (CCDC183) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dolutegravir Sodium Salt
TRC-D528805-10MG 10 mg

Dolutegravir Sodium Salt

Sign In for Pricing
View Details