Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK7 Peptide - N-terminal region

CDK7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAK1, CDKN7, HCAK, MO15, STK1, p39MO15

UniProt

P50613

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDK7 Rabbit Polyclonal Antibody (orb573765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001790

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Bis(2,4,6-tribromophenoxy)ethane-13C12
TRC-B585428-1MG 1 mg

1,2-Bis(2,4,6-tribromophenoxy)ethane-13C12

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS509090 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Cfap97 Mouse Gene Knockout Kit (CRISPR)
KN500445 1 Kit

Cfap97 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DPP6 Polyclonal Antibody
E-AB-90106-01 60 µL

DPP6 Polyclonal Antibody

Sign In for Pricing
View Details
DPP6 Polyclonal Antibody
E-AB-90106-02 120 µL

DPP6 Polyclonal Antibody

Sign In for Pricing
View Details
DPP6 Polyclonal Antibody
E-AB-90106-03 200 µL

DPP6 Polyclonal Antibody

Sign In for Pricing
View Details