Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXO6 Peptide - middle region

FOXO6 Peptide - middle region

Product Specifications

UniProt

A6NCE0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXO6 Rabbit Polyclonal Antibody (orb574050) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSYADLITKAIESAPDKRLTLSQIYDWMVRYVPYFKDKGDSNSSAGWKNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Apolipoprotein L3 (APOL3) ELISA Kit
MBS7204014-01 48 Well

Porcine Apolipoprotein L3 (APOL3) ELISA Kit

Sign In for Pricing
View Details
Porcine Apolipoprotein L3 (APOL3) ELISA Kit
MBS7204014-02 96 Well

Porcine Apolipoprotein L3 (APOL3) ELISA Kit

Sign In for Pricing
View Details
Porcine Apolipoprotein L3 (APOL3) ELISA Kit
MBS7204014-03 5x 96 Well

Porcine Apolipoprotein L3 (APOL3) ELISA Kit

Sign In for Pricing
View Details
Porcine Apolipoprotein L3 (APOL3) ELISA Kit
MBS7204014-04 10x 96 Well

Porcine Apolipoprotein L3 (APOL3) ELISA Kit

Sign In for Pricing
View Details
Adiponectin ELISA Kit
GWB-265BBA 96 Tests

Adiponectin ELISA Kit

Sign In for Pricing
View Details
TRAT1 Protein Vector (Rat) (pPM-C-HA)
PV312772 500 ng

TRAT1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details