Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXO6 Peptide - middle region

FOXO6 Peptide - middle region

Product Specifications

UniProt

A6NCE0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXO6 Rabbit Polyclonal Antibody (orb574050) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSYADLITKAIESAPDKRLTLSQIYDWMVRYVPYFKDKGDSNSSAGWKNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ML-265
C4181-25 25 mg

ML-265

Sign In for Pricing
View Details
Bovine Amylase Alpha ELISA Kit
MBS089790-01 48 Well

Bovine Amylase Alpha ELISA Kit

Sign In for Pricing
View Details
Bovine Amylase Alpha ELISA Kit
MBS089790-02 96 Well

Bovine Amylase Alpha ELISA Kit

Sign In for Pricing
View Details
Bovine Amylase Alpha ELISA Kit
MBS089790-03 5x 96 Well

Bovine Amylase Alpha ELISA Kit

Sign In for Pricing
View Details
Bovine Amylase Alpha ELISA Kit
MBS089790-04 10x 96 Well

Bovine Amylase Alpha ELISA Kit

Sign In for Pricing
View Details
PSF3 (GINS3) (NM_022770) Human Over-expression Lysate
LS064785-100ug 100 µg

PSF3 (GINS3) (NM_022770) Human Over-expression Lysate

Sign In for Pricing
View Details