BAZ2B Peptide - middle region
BAZ2B Peptide - middle region
Product Specifications
Product Name Alternative
WALp4
UniProt
Q9UIF8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BAZ2B Rabbit Polyclonal Antibody (orb324425) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001276904.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NRKCNQEQSKNQPLDARVDKIKDKKPRKKAMESSSNSDSDSGTSSDTSSE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9319659-01 48 Well
Human Gamma-secretase subunit APH-1B, APH1B ELISA Kit
Sign In for Pricing
View Details MBS9319659-02 96 Well
Human Gamma-secretase subunit APH-1B, APH1B ELISA Kit
Sign In for Pricing
View Details MBS9319659-03 5x 96 Well
Human Gamma-secretase subunit APH-1B, APH1B ELISA Kit
Sign In for Pricing
View Details MBS9319659-04 10x 96 Well
Human Gamma-secretase subunit APH-1B, APH1B ELISA Kit
Sign In for Pricing
View Details