ZNF232 Peptide - C-terminal region
ZNF232 Peptide - C-terminal region
Product Specifications
UniProt
Q9UNY5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF232 Rabbit Polyclonal Antibody (orb574454) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YECNECGKAFSQSSYLSQHRRIHSGEKPFICKECGKAYGWCSELIRHRRV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-UNEL-M0003-01 5x 96 Tests
Uncoated Mouse LEPR (Leptin Receptor) ELISA Kit
Sign In for Pricing
View Details E-UNEL-M0003-02 15x 96 Tests
Uncoated Mouse LEPR (Leptin Receptor) ELISA Kit
Sign In for Pricing
View Details 
![PKC delta Recombinant Rabbit Monoclonal Antibody [JJ093-02]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea81eac/imageurl/et1701-85.webp)
ET1701-85 100 µL
PKC delta Recombinant Rabbit Monoclonal Antibody [JJ093-02]
Sign In for Pricing
View Details