Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UTY Peptide - N-terminal region

UTY Peptide - N-terminal region

Product Specifications

Product Name Alternative

UTY1

UniProt

O14607

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UTY Rabbit Polyclonal Antibody (orb574687) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872601

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLLLEDYSKALSAYQRYYSLQADYWKNAAFLYGLGLVYFYYNAFHWAIKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (5-Nitro-2-thiophene) acrylic Acid-d4 Sulfadimidine Amide
018409 1 mg

3- (5-Nitro-2-thiophene) acrylic Acid-d4 Sulfadimidine Amide

Sign In for Pricing
View Details
APRT-set siRNA/shRNA/RNAi Lentivector (Human)
12212091 4x 500 ng

APRT-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Trinexapac-d5
TRC-T886317-10MG 10 mg

Trinexapac-d5

Sign In for Pricing
View Details
Mouse Monoclonal TERT Antibody (2C4)
NB100-317SS 0.025 mL

Mouse Monoclonal TERT Antibody (2C4)

Sign In for Pricing
View Details
IRF2BP2 Polyclonal Antibody, Cy5 Conjugated
bs-16701R-Cy5 100 µL

IRF2BP2 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Anti-NF-kappaB p105 (pS927) Antibody
MBS9239207-01 0.05 mL

Anti-NF-kappaB p105 (pS927) Antibody

Sign In for Pricing
View Details