Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKD2 Peptide - N-terminal region

PKD2 Peptide - N-terminal region

Product Specifications

UniProt

Q13563

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PKD2 Rabbit Polyclonal Antibody (orb575322) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYCSP35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0546506 1.0 µg DNA

CYCSP35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Human HMGB3 Protein
MBS8249162-01 0.01 mg

Recombinant Human HMGB3 Protein

Sign In for Pricing
View Details
Recombinant Human HMGB3 Protein
MBS8249162-02 0.05 mg

Recombinant Human HMGB3 Protein

Sign In for Pricing
View Details
Recombinant Human HMGB3 Protein
MBS8249162-03 0.5 mg

Recombinant Human HMGB3 Protein

Sign In for Pricing
View Details
Recombinant Human HMGB3 Protein
MBS8249162-04 5x 0.5 mg

Recombinant Human HMGB3 Protein

Sign In for Pricing
View Details
Major Basic Protein (MBP) BioAssayTM ECL ELISA Kit (Mouse)
157945 96 Tests

Major Basic Protein (MBP) BioAssayTM ECL ELISA Kit (Mouse)

Sign In for Pricing
View Details