Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKD2 Peptide - N-terminal region

PKD2 Peptide - N-terminal region

Product Specifications

UniProt

Q13563

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PKD2 Rabbit Polyclonal Antibody (orb575322) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASIP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
38544111 3x 1.0 µg

RASIP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
SPQ
BUP16085-01 50 mg

SPQ

Sign In for Pricing
View Details
SPQ
BUP16085-02 100 mg

SPQ

Sign In for Pricing
View Details
Rabbit anti-Shigella flexneri SPEA Polyclonal Antibody
MBS9000551 Inquire

Rabbit anti-Shigella flexneri SPEA Polyclonal Antibody

Sign In for Pricing
View Details
GDPD2 (NM_001171191) Human Tagged ORF Clone Lentiviral Particle
RC230122L4V 200 µL

GDPD2 (NM_001171191) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-CARM1 Antibody Picoband® Fluoro647 Conjugated
A01486-1-Fluoro647 100 µg/Vial

Anti-CARM1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details