ELF1 Peptide - C-terminal region
ELF1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
RIA1, EFTUD1
UniProt
Q6MZZ4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ELF1 Rabbit Polyclonal Antibody (orb324666) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TQETKTLTQEVEKKESEDHLKENTEKTEQQPQPYVMVVSSSNGFTSQVAM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
040327-ML405 100 µL
PPM1H, ID (PPM1H, ARHCL1, KIAA1157, URCC2, Protein phosphatase 1H) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
040175-ML650 100 µL
Plk3, NT (Plk3, Cnk, Fnk, Serine/threonine-protein kinase PLK3, Cytokine-inducible serine/threonine-protein kinase, FGF-inducible kinase, Polo-like kinase 3) (MaxLight 650) discontinued
Sign In for Pricing
View Details 