Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELF1 Peptide - C-terminal region

ELF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RIA1, EFTUD1

UniProt

Q6MZZ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELF1 Rabbit Polyclonal Antibody (orb324666) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQETKTLTQEVEKKESEDHLKENTEKTEQQPQPYVMVVSSSNGFTSQVAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amikacin antigen, BSA Conjugated
BDA1101-A 1 mg

Amikacin antigen, BSA Conjugated

Sign In for Pricing
View Details
Anti-Streptococci Group A [Clone HSA12-310.2] - 1mg
15501-1mg 1 mg

Anti-Streptococci Group A [Clone HSA12-310.2] - 1mg

Sign In for Pricing
View Details
BVR Antibody: Biotin
MBS806687-01 0.1 mg

BVR Antibody: Biotin

Sign In for Pricing
View Details
BVR Antibody: Biotin
MBS806687-02 5x 0.1 mg

BVR Antibody: Biotin

Sign In for Pricing
View Details
Srgn siRNA Oligos set (Mouse)
45464174 3x 5 nmol

Srgn siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
GHITM Antibody
E94641 100 µg

GHITM Antibody

Sign In for Pricing
View Details