ERCC6 Peptide - C-terminal region
ERCC6 Peptide - C-terminal region
Product Specifications
UniProt
F5H493
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ERCC6 Rabbit Polyclonal Antibody (orb576473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EASALLPTTEHDDLLVEMRNFIAFQAHTDGQASTREILQEFESKLSASQS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![4-Amino-1-[3,5-bis-O-(4-chlorobenzoyl)-2-deoxy-beta-D-erythro-pentofuranosyl]-1,3,5-triazin-2(1H)-one](https://cdn.genprice.uk/products/572/7789591977517/imageurl/trc-a601705-25mg.webp)
TRC-A601705-25MG 25 mg
4-Amino-1-[3,5-bis-O-(4-chlorobenzoyl)-2-deoxy-beta-D-erythro-pentofuranosyl]-1,3,5-triazin-2(1H)-one
Sign In for Pricing
View Details 
BNC041996-500 1x 500 µL
HCG-beta (Pregnancy & Choriocarcinoma Marker) (HCGb/1996R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP50968PU-N 400 µL
CD300 (CD300LF) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 