Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERCC6 Peptide - C-terminal region

ERCC6 Peptide - C-terminal region

Product Specifications

UniProt

F5H493

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERCC6 Rabbit Polyclonal Antibody (orb576473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EASALLPTTEHDDLLVEMRNFIAFQAHTDGQASTREILQEFESKLSASQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Piritramide
TRC-P508800-2.5MG 2.5 mg

Piritramide

Sign In for Pricing
View Details
Cytokeratin 5+6 Rabbit Polyclonal Antibody
ER1901-03 100 µL

Cytokeratin 5+6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Arbutamine
TRC-A766300-5MG 5 mg

Arbutamine

Sign In for Pricing
View Details
SLC35B2 (C-term) Rabbit Polyclonal Antibody
AP53780PU-N 400 µL

SLC35B2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Fluoroethyl Chloroformate
TRC-F591530-1G 1 g

2-Fluoroethyl Chloroformate

Sign In for Pricing
View Details
HLAA (HLA-A) Human Gene Knockout Kit (CRISPR)
KN400661 1 Kit

HLAA (HLA-A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details