Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAZ2B Peptide - middle region

BAZ2B Peptide - middle region

Product Specifications

Product Name Alternative

WALp4

UniProt

Q9UIF8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BAZ2B Rabbit Polyclonal Antibody (orb324775) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001276904.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSTTASSSMGQTKSTSSGGGNRKCNQEQSKNQPLDARVDKIKDKKPRKKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF740 conjugate, 0.1mg/mL
BNC742983-500 1x 500 µL

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, multi (KRT/457), CF488A conjugate, 0.1mg/mL
BNC880457-500 1x 500 µL

Cytokeratin, multi (KRT/457), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Amino-4-chloro-3-nitropyridine
TRC-A603485-50MG 50 mg

2-Amino-4-chloro-3-nitropyridine

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon: transverse
CB538642 1 Block

Frozen Tissue Blocks, Colon: transverse

Sign In for Pricing
View Details
Recombinant Human CLIC1 Protein (His Tag)
PKSH032246-01 10 µg

Recombinant Human CLIC1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CLIC1 Protein (His Tag)
PKSH032246-02 50 µg

Recombinant Human CLIC1 Protein (His Tag)

Sign In for Pricing
View Details