ARNT2 Peptide - N-terminal region
ARNT2 Peptide - N-terminal region
Product Specifications
UniProt
Q86TN1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARNT2 Rabbit Polyclonal Antibody (orb576979) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC742571-100 1x 100 µL
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC402073 20 µg
Nogo A (RTN4) (NM_007008) Human Over-expression Lysate
Sign In for Pricing
View Details