Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARNT2 Peptide - N-terminal region

ARNT2 Peptide - N-terminal region

Product Specifications

UniProt

Q86TN1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARNT2 Rabbit Polyclonal Antibody (orb576979) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ube2w Mouse Gene Knockout Kit (CRISPR)
KN518595 1 Kit

Ube2w Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BstFNI, 100U
RE1220 100 U

BstFNI, 100U

Sign In for Pricing
View Details
BAFF Human, His
OM297010-01 20 µg

BAFF Human, His

Sign In for Pricing
View Details
BAFF Human, His
OM297010-02 5 µg

BAFF Human, His

Sign In for Pricing
View Details
BAFF Human, His
OM297010-03 1 mg

BAFF Human, His

Sign In for Pricing
View Details
5-Azacytidine
P012-50MG 50 mg

5-Azacytidine

Sign In for Pricing
View Details