Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM5 Peptide - N-terminal region

PRDM5 Peptide - N-terminal region

Product Specifications

UniProt

Q9NQX1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRDM5 Rabbit Polyclonal Antibody (orb577086) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEVRGSKGEVLYI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Masson's Trichrome Staining Kit
C0189M 500 Tests

Masson's Trichrome Staining Kit

Sign In for Pricing
View Details
OR6C70 AAV siRNA Pooled Vector
35500161 1.0 µg

OR6C70 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Tacr1 (NM_009313) Mouse Tagged ORF Clone
MG206405 10 µg

Tacr1 (NM_009313) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Lrrtm2 Mouse shRNA Plasmid (Locus ID 107065)
TR509735 1 Kit

Lrrtm2 Mouse shRNA Plasmid (Locus ID 107065)

Sign In for Pricing
View Details
Rps5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
42580114 3x 1.0 µg

Rps5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
DUX4L2 siRNA Oligos set (Human)
18721171 3x 5 nmol

DUX4L2 siRNA Oligos set (Human)

Sign In for Pricing
View Details