Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM5 Peptide - N-terminal region

PRDM5 Peptide - N-terminal region

Product Specifications

UniProt

Q9NQX1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRDM5 Rabbit Polyclonal Antibody (orb577086) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEVRGSKGEVLYI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hs3st6 Mouse shRNA Plasmid (Locus ID 328779)
TL513115 1 Kit

Hs3st6 Mouse shRNA Plasmid (Locus ID 328779)

Sign In for Pricing
View Details
Human High affinity copper uptake protein 1 (SLC31A1) ELISA Kit
GTR10319766 96 Well

Human High affinity copper uptake protein 1 (SLC31A1) ELISA Kit

Sign In for Pricing
View Details
(4S) -1-Boc-4-amino-D-proline
OR1007163-01 100 mg

(4S) -1-Boc-4-amino-D-proline

Sign In for Pricing
View Details
(4S) -1-Boc-4-amino-D-proline
OR1007163-02 250 mg

(4S) -1-Boc-4-amino-D-proline

Sign In for Pricing
View Details
(4S) -1-Boc-4-amino-D-proline
OR1007163-03 1 g

(4S) -1-Boc-4-amino-D-proline

Sign In for Pricing
View Details
(4S) -1-Boc-4-amino-D-proline
OR1007163-04 5 g

(4S) -1-Boc-4-amino-D-proline

Sign In for Pricing
View Details