CBX4 Peptide - middle region
CBX4 Peptide - middle region
Product Specifications
UniProt
O00257
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CBX4 Rabbit Polyclonal Antibody (orb577105) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKPKPLV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
FP-159 1 Vial 100 μL (10-20 T)
MALT1/IGH gene fusion t (14; 18) probe
Sign In for Pricing
View Details