CBX4 Peptide - middle region
CBX4 Peptide - middle region
Product Specifications
UniProt
O00257
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CBX4 Rabbit Polyclonal Antibody (orb577105) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKPKPLV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VK673012-01 50 µg
Recombinant HMPV G/Major surface glycoprotein G Protein, N-His
Sign In for Pricing
View Details VK673012-02 100 µg
Recombinant HMPV G/Major surface glycoprotein G Protein, N-His
Sign In for Pricing
View Details VK673012-03 1 mg
Recombinant HMPV G/Major surface glycoprotein G Protein, N-His
Sign In for Pricing
View Details 
MBS1392001-01 0.02 mg (E-Coli)
Recombinant Human Zinc finger and BTB domain-containing protein 3 (ZBTB3)
Sign In for Pricing
View Details MBS1392001-02 0.02 mg (Yeast)
Recombinant Human Zinc finger and BTB domain-containing protein 3 (ZBTB3)
Sign In for Pricing
View Details