FZD4 Peptide - C-terminal region
FZD4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Fz4, EVR1, FEVR, Fz-4, FzE4, GPCR, hFz4, CD344, FZD4S
UniProt
Q9ULV1
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FZD4 Rabbit Polyclonal Antibody (orb324947) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036325.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940040-100 1x 100 µL
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741989-100 1x 100 µL
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400969-100 1x 100 µL
Ep-CAM / CD326 (Cocktail PAN-EpCAM), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 