Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELAC2 Peptide - C-terminal region

ELAC2 Peptide - C-terminal region

Product Specifications

UniProt

Q9BQ52

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELAC2 Rabbit Polyclonal Antibody (orb578012) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITCNPEEFIVEALQLPNFQQSVQEYRRSAQDGPAPAEKRSQYPEIIFLGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nectin 2 (E-1) : m-IgG Fc BP-HRP Bundle
sc-529146 1 Kit

Nectin 2 (E-1) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (APC)
MBS6167818-01 0.1 mL

HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (APC)

Sign In for Pricing
View Details
HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (APC)
MBS6167818-02 5x 0.1 mL

HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (APC)

Sign In for Pricing
View Details
Neutrophil gelatinase-associated lipocalin
orb1645599-01 50 µg

Neutrophil gelatinase-associated lipocalin

Sign In for Pricing
View Details
Neutrophil gelatinase-associated lipocalin
orb1645599-02 100 µg

Neutrophil gelatinase-associated lipocalin

Sign In for Pricing
View Details
Neutrophil gelatinase-associated lipocalin
orb1645599-03 1 mg

Neutrophil gelatinase-associated lipocalin

Sign In for Pricing
View Details