Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELAC2 Peptide - C-terminal region

ELAC2 Peptide - C-terminal region

Product Specifications

UniProt

Q9BQ52

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELAC2 Rabbit Polyclonal Antibody (orb578012) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITCNPEEFIVEALQLPNFQQSVQEYRRSAQDGPAPAEKRSQYPEIIFLGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ENTPD2/CD39L1 Antibody , APC
E55A08913 50 Tests

Human ENTPD2/CD39L1 Antibody , APC

Sign In for Pricing
View Details
PathScan® Total Tyro3 Sandwich ELISA Kit
CST 39412C 1 Kit

PathScan® Total Tyro3 Sandwich ELISA Kit

Sign In for Pricing
View Details
Phospho-c-Cbl (Tyr774) Antibody
CST 3555S 100 µL

Phospho-c-Cbl (Tyr774) Antibody

Sign In for Pricing
View Details
N4-Ethyl-CTP
NU-1191S 20 µL

N4-Ethyl-CTP

Sign In for Pricing
View Details
Anti-Hu CD52 Purified
11-368-C025 0.025 mg

Anti-Hu CD52 Purified

Sign In for Pricing
View Details
Mouse Integrin Beta 5 ELISA Kit
MBS085099-01 48 Well

Mouse Integrin Beta 5 ELISA Kit

Sign In for Pricing
View Details