Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C8G Peptide - N-terminal region

C8G Peptide - N-terminal region

Product Specifications

Product Name Alternative

C8C

UniProt

P07360

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C8G Rabbit Polyclonal Antibody (orb324966) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000597

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pten Mouse Gene Knockout Kit (CRISPR)
KN314163LP 1 Kit

Pten Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SOX9 Human Gene Knockout Kit (CRISPR)
KN208944 1 Kit

SOX9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CAMK2A (C-term) Rabbit Polyclonal Antibody
AP14062PU-N 400 µL

CAMK2A (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2442), CF740 conjugate, 0.1mg/mL
BNC742442-100 1x 100 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2442), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Ccs activation kit by CRISPRa
GA200592 1 Kit

Mouse Ccs activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB511211 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details