C8G Peptide - N-terminal region
C8G Peptide - N-terminal region
Product Specifications
Product Name Alternative
C8C
UniProt
P07360
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C8G Rabbit Polyclonal Antibody (orb324966) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000597
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![(7a,17b)-17-Hydroxy-7-[9-[(4,4,5,5,5-pentafluoropentyl)sulfinyl]nonyl]androst-4-en-3-one](https://cdn.genprice.uk/products/572/12124519/imageurl/trc-h244540-2.5mg.webp)
TRC-H244540-2.5MG 2.5 mg
(7a,17b)-17-Hydroxy-7-[9-[(4,4,5,5,5-pentafluoropentyl)sulfinyl]nonyl]androst-4-en-3-one
Sign In for Pricing
View Details 
BNC743145-100 1x 100 µL
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/3145), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
22603-AAT 200 Tests
Live or Dead™ Fixable Dead Cell Staining Kit *Red Fluorescence*
Sign In for Pricing
View Details 
