CYB561 Peptide - N-terminal region
CYB561 Peptide - N-terminal region
Product Specifications
UniProt
F5H757
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CYB561 Rabbit Polyclonal Antibody (orb324978) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GAWLGLYRGGIAWESDLQFNAHPLCMVIGLIFLQGNALLVYRVFRNEAKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC683792-100 1x 100 µL
Erythropoietin (EPO) (Marker of Placentation Disorders) (rEPO/1367), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![AGR2 Mouse Monoclonal Antibody [Clone ID: OTI5D8]](https://cdn.genprice.uk/products/937/68dd18ba061270361e9086bd/imageurl/cf809755.webp)