CYB561 Peptide - N-terminal region
CYB561 Peptide - N-terminal region
Product Specifications
UniProt
F5H757
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CYB561 Rabbit Polyclonal Antibody (orb324978) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GAWLGLYRGGIAWESDLQFNAHPLCMVIGLIFLQGNALLVYRVFRNEAKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC400525 20 µg
Casein Kinase 2 beta (CSNK2B) (NM_001320) Human Over-expression Lysate
Sign In for Pricing
View Details ![ZFYVE1 Mouse Monoclonal Antibody [Clone ID: OTI1A2]](https://cdn.genprice.uk/products/937/68dd18ba061270361e90879e/imageurl/cf810160.webp)
CF810160 100 µg
ZFYVE1 Mouse Monoclonal Antibody [Clone ID: OTI1A2]
Sign In for Pricing
View Details 
TA362176 100 µL
Angiopoietin like 7 (ANGPTL7) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNC042465-100 1x 100 µL
Ki-67 (Proliferating Cell Marker) (MKI67/2465), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details