Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELMO3 Peptide - C-terminal region

ELMO3 Peptide - C-terminal region

Product Specifications

UniProt

Q96BJ8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELMO3 Rabbit Polyclonal Antibody (orb330250) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLALKPTSLELFRTKVNALTYGEVLRLRQTERLHQEGTLAPPILELREKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgM Anti SARS-CoV-2 Spike (S1) RBD Antibody (DH6)
MAB12491-100 1 Each

Human IgM Anti SARS-CoV-2 Spike (S1) RBD Antibody (DH6)

Sign In for Pricing
View Details
LOH12CR1 Antibody, Biotin conjugated
MBS1497000-01 0.05 mg

LOH12CR1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
LOH12CR1 Antibody, Biotin conjugated
MBS1497000-02 0.1 mg

LOH12CR1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
LOH12CR1 Antibody, Biotin conjugated
MBS1497000-03 5x 0.1 mg

LOH12CR1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mir1945 Mouse MicroRNA Expression Plasmid (MI0009934)
SC400859 10 µg

Mir1945 Mouse MicroRNA Expression Plasmid (MI0009934)

Sign In for Pricing
View Details
Rat Autophagy related protein 16 2 (ATG16L2) ELISA kit
GTR10432008 96 Well

Rat Autophagy related protein 16 2 (ATG16L2) ELISA kit

Sign In for Pricing
View Details