Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELMO3 Peptide - C-terminal region

ELMO3 Peptide - C-terminal region

Product Specifications

UniProt

Q96BJ8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELMO3 Rabbit Polyclonal Antibody (orb330250) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLALKPTSLELFRTKVNALTYGEVLRLRQTERLHQEGTLAPPILELREKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSDC2 rabbit pAb
UB-GEN-8687 100 µL

CSDC2 rabbit pAb

Sign In for Pricing
View Details
NUR77/NR4A1 Rabbit Polyclonal Antibody (APC)
orb2577667 100 µg

NUR77/NR4A1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
PTGDR2 siRNA (Human)
orb1860546-01 15 nmol

PTGDR2 siRNA (Human)

Sign In for Pricing
View Details
PTGDR2 siRNA (Human)
orb1860546-02 30 nmol

PTGDR2 siRNA (Human)

Sign In for Pricing
View Details
Lentiviral mouse Usp10 shRNA (UAS) - Lentiviral mouse Usp10 shRNA (UAS, GFP) (100)
GTR15299616 1 Vial

Lentiviral mouse Usp10 shRNA (UAS) - Lentiviral mouse Usp10 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
PCGF2 (polycomb Group Ring Finger 2, MEL-18, MGC10545, RNF110, ZNF144) (AP) discontinued
249861-AP 100 µL

PCGF2 (polycomb Group Ring Finger 2, MEL-18, MGC10545, RNF110, ZNF144) (AP) discontinued

Sign In for Pricing
View Details