Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C4orf3 Peptide - middle region

C4orf3 Peptide - middle region

Product Specifications

UniProt

Q8WVX3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C4orf3 Rabbit Polyclonal Antibody (orb579159) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001163801

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSEMEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSYWLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Focal adhesion kinase 1 Antibody, mAb, Rabbit
A02846-50 50 µL

Focal adhesion kinase 1 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Rabbit Anti Human THAP10 Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (IHC,ELISA) 200ul
IRBAHUTHAP10AAP222200UL 200 µL

Rabbit Anti Human THAP10 Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (IHC,ELISA) 200ul

Sign In for Pricing
View Details
SNRNP200 Protein Vector (Mouse) (pPM-C-HA)
44959024 500 ng

SNRNP200 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Lysine--tRNA ligase (lysS), partial
MBS1161836 Inquire

Recombinant Salmonella heidelberg Lysine--tRNA ligase (lysS), partial

Sign In for Pricing
View Details
MPDU1 Knockout HEK293T Polyclonal Cells
ARG4236 1 Million

MPDU1 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Olfr1309 3'UTR GFP Stable Cell Line
TU164815 1.0 mL

Olfr1309 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details