C4orf3 Peptide - middle region
C4orf3 Peptide - middle region
Product Specifications
UniProt
Q8WVX3
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C4orf3 Rabbit Polyclonal Antibody (orb579159) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001163801
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RSEMEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSYWLD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Human Kappa Light Chain (free and bound) Mouse Monoclonal Antibody [Clone ID: NI 285, NI 250]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
AM20244TC-N 200 µg
Human Kappa Light Chain (free and bound) Mouse Monoclonal Antibody [Clone ID: NI 285, NI 250]
Sign In for Pricing
View Details 
MBS6131380-01 0.1 mL
FXN (Frataxin, Mitochondrial, Friedreich Ataxia Protein, Frataxin Intermediate Form, Frataxin(56-210), Frataxin(81-210), FRDA, X25) (AP)
Sign In for Pricing
View Details MBS6131380-02 5x 0.1 mL
FXN (Frataxin, Mitochondrial, Friedreich Ataxia Protein, Frataxin Intermediate Form, Frataxin(56-210), Frataxin(81-210), FRDA, X25) (AP)
Sign In for Pricing
View Details