Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCUN1D4 Peptide - N-terminal region

DCUN1D4 Peptide - N-terminal region

Product Specifications

UniProt

Q92564

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCUN1D4 Rabbit Polyclonal Antibody (orb582361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055930

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLNKLNLTEDIGQDDHQTGSLRSCSSSDCFNKVMPPRKKRRPASGDDLSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Procollagen Type III N-Terminal Propeptide (PIIINP) Antibody Pair
abx370794-01 5x 96 Tests

Procollagen Type III N-Terminal Propeptide (PIIINP) Antibody Pair

Sign In for Pricing
View Details
Procollagen Type III N-Terminal Propeptide (PIIINP) Antibody Pair
abx370794-02 10x 96 Tests

Procollagen Type III N-Terminal Propeptide (PIIINP) Antibody Pair

Sign In for Pricing
View Details
Recombinant Pseudomonas putida UPF0312 protein PputW619_0484 (PputW619_0484)
MBS1016424-01 0.02 mg (E-Coli)

Recombinant Pseudomonas putida UPF0312 protein PputW619_0484 (PputW619_0484)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida UPF0312 protein PputW619_0484 (PputW619_0484)
MBS1016424-02 0.1 mg (E-Coli)

Recombinant Pseudomonas putida UPF0312 protein PputW619_0484 (PputW619_0484)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida UPF0312 protein PputW619_0484 (PputW619_0484)
MBS1016424-03 0.02 mg (Yeast)

Recombinant Pseudomonas putida UPF0312 protein PputW619_0484 (PputW619_0484)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida UPF0312 protein PputW619_0484 (PputW619_0484)
MBS1016424-04 0.1 mg (Yeast)

Recombinant Pseudomonas putida UPF0312 protein PputW619_0484 (PputW619_0484)

Sign In for Pricing
View Details