Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCUN1D4 Peptide - N-terminal region

DCUN1D4 Peptide - N-terminal region

Product Specifications

UniProt

Q92564

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCUN1D4 Rabbit Polyclonal Antibody (orb582361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055930

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLNKLNLTEDIGQDDHQTGSLRSCSSSDCFNKVMPPRKKRRPASGDDLSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP19
enz-201 2µg

DUSP19

Sign In for Pricing
View Details
Y-39983 dihydrochloride
B1176-10 10 mg

Y-39983 dihydrochloride

Sign In for Pricing
View Details
Ankyrin Repeat Domain Protein 1 (ANKRD1) Polyclonal Antibody
CAU22139-01 100 µL

Ankyrin Repeat Domain Protein 1 (ANKRD1) Polyclonal Antibody

Sign In for Pricing
View Details
Ankyrin Repeat Domain Protein 1 (ANKRD1) Polyclonal Antibody
CAU22139-02 200 µL

Ankyrin Repeat Domain Protein 1 (ANKRD1) Polyclonal Antibody

Sign In for Pricing
View Details
Ankyrin Repeat Domain Protein 1 (ANKRD1) Polyclonal Antibody
CAU22139-03 1 mL

Ankyrin Repeat Domain Protein 1 (ANKRD1) Polyclonal Antibody

Sign In for Pricing
View Details
CALHM3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
14931156 3x 1.0 µg DNA

CALHM3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details